You have no items in your shopping cart.
BABAM2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | BABAM2 |
| Protein Sequence | Synthetic peptide located within the following region: YHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFAN |
| Molecular Weight | 43kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BABAM2 Rabbit Polyclonal Antibody [orb100084]
IF, IHC-Fr, IHC-P, WB
Canine, Equine, Gallus, Human, Rabbit, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μlBABAM2 Rabbit Polyclonal Antibody [orb2953515]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rabbit Anti-BRE Antibody, Catalog Number: orb585277, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-BRE Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell. BRE is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells.
Documents Download
Request a Document
Protocol Information
BABAM2 Rabbit Polyclonal Antibody (orb585277)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






