Cart summary

You have no items in your shopping cart.

B4GALNT3 Rabbit Polyclonal Antibody (FITC)

B4GALNT3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2113479

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113479
CategoryAntibodies
DescriptionB4GALNT3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human B4GALNT3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW115kDa
UniProt IDQ6L9W6
Protein SequenceSynthetic peptide located within the following region: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
NCBINP_775864
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesB4GalNac-T3, FLJ16224, FLJ40362
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.