B3galt2 Rabbit Polyclonal Antibody

• Catalog Number: orb579494
• Category: Antibodies
• Description: Rabbit polyclonal antibody to B3galt2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: B3galt2
• UniProt ID: O54905
• Protein Sequence: Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
• NCBI: NP_064409
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse NIH 373 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Adult mouse cortex, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: B3Galt2 Cyan: Nissl(Neurons), Gene Name: B3galt2.

WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Mouse Brain.