B3GALNT1 Rabbit Polyclonal Antibody

• Catalog Number: orb579315
• Category: Antibodies
• Description: Rabbit polyclonal antibody to B3GALNT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human B3GALNT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: B3GALNT1
• UniProt ID: O75752
• Protein Sequence: Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
• NCBI: NP_001033717
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P, P1, GLOB, GLCT3, galT3, Gb4Cer, B3GALT3, beta3G
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 53 kDa, 40 kDa, 38 kDa, and 24 kDa. The protein may also be glycosylated at several sites.

WB Suggested Anti-B3GALNT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.