B3GALNT1 Rabbit Polyclonal Antibody

• Catalog Number: orb579315
• Category: Antibodies
• Description: Rabbit polyclonal antibody to B3GALNT1
• Target: B3GALNT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human B3GALNT1
• Protein Sequence: Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
• UniProt ID: O75752
• MW: 40 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P, P1, GLOB, GLCT3, galT3, Gb4Cer, B3GALT3, beta3G
• Research Area: Cell Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_001033717

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 53 kDa, 40 kDa, 38 kDa, and 24 kDa. The protein may also be glycosylated at several sites.

WB Suggested Anti-B3GALNT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.