B3GALNT1 Rabbit Polyclonal Antibody

SKU: orb579315

Description

Rabbit polyclonal antibody to B3GALNT1

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human B3GALNT1
• Target: B3GALNT1
• Protein Sequence: Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
• Molecular Weight: 40 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P, P1, GLOB, GLCT3, galT3, Gb4Cer, B3GALT3, beta3Gal-T3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 53 kDa, 40 kDa, 38 kDa, and 24 kDa. The protein may also be glycosylated at several sites.

WB Suggested Anti-B3GALNT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.

Quick Database Links

Gene Symbol

B3GALNT1

UniProt

O75752

RefSeq (Protein):NP_001033717