You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573823 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Avil |
Target | Avil |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ |
UniProt ID | Q9WU06 |
MW | 91kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_077377 |
WB Suggested Anti-Avil Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Muscle.
FC, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |