AURKB Rabbit Polyclonal Antibody

SKU: orb331533

Description

AURKB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AURKB. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human AURKB. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AURKB
• Target: AURKB
• Protein Sequence: Synthetic peptide located within the following region: AQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTA
• Molecular Weight: 39 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AIK2 antibody, anti AIM1 antibody, anti ARK2 antibody, anti AurB antibody, anti IPL1 antibody, anti STK5 antibody, anti AIM-1 antibody, anti STK12 antibody, anti PPP1R48 antibody, anti aurkb-sv1 antibody, anti aurkb-sv2 antibody

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

AURKB

UniProt

Q96GD4

RefSeq (Protein):NP_001243763.1