You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb180467 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to ATXN3. This protein appears to be a component of the ubiquitin proteasome system and has deubiquitinase activity. It may also have roles in neuroprotection, protein homeostasis maintenance, transcriptional and cytoskeleton regulation, myogenesis and degradation of misfolded chaperone substrates. The protein contains Qn repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease also known as spinocerebellar ataxia-3, an autosomal dominant neurologic disorder. |
Target | Ataxin 3 |
Clonality | Polyclonal |
Species/Host | Goat |
Isotype | IgG |
Conjugation | Unconjugated |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Concentration | 1 mg/ml |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli.. Antigen Sequence: KEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADL |
Tested applications | WB |
Dilution range | WB:1:250-1:2,000 |
Application notes | The antibody solution should be gently mixed before use. |
Antibody Type | Primary Antibody |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AT3, ATX3, ataxin-3, ataxin 3 variant h, autosomal Read more... |
Note | For research use only |
Western blot analysis of SH-SY5Y cell line lysate using ATXN3 antibody.
FC, ICC, IF, IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |