Cart summary

You have no items in your shopping cart.

ATP6V1C1 Rabbit Polyclonal Antibody (FITC)

ATP6V1C1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2099847

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2099847
CategoryAntibodies
DescriptionATP6V1C1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1C1
Protein SequenceSynthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
UniProt IDP21283
MW42kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesVATC, Vma5, ATP6C, ATP6D
NoteFor research use only
NCBINP_001686