ATP6V1C1 Rabbit Polyclonal Antibody

• Catalog Number: orb584049
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP6V1C1
• Target: ATP6V1C1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1C1
• Protein Sequence: Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
• UniProt ID: P21283
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: VATC, Vma5, ATP6C, ATP6D
• Note: For research use only
• NCBI: NP_001686

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-ATP6V1C1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.