You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325998 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP6V0D2 |
Target | ATP6V0D2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2 |
Protein Sequence | Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI |
UniProt ID | Q8N8Y2 |
MW | 40 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ATP6D2 antibody, anti FLJ38708 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_689778 |
25 ug of the indicated Human tumor tissue cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. This protein seems to migrate higher than it's amino acid sequence predicts.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-ATP6V0D2 Antibody Titration: 0.2-1 ug/mL. A: 5 ug empty vector. B: 5 ug hATP6V0D2 transfected HEK293T.
WB Suggested Anti-ATP6V0D2 Antibody Titration: 0.2-1 ug/mL. ELISA Titer: 1:62500. Positive Control: Transfected 293T.
WB | |
Canine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Canine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
AP |