Atp6v0a1 Rabbit Polyclonal Antibody

• Catalog Number: orb576251
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Atp6v0a1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 96 kDa
• Target: Atp6v0a1
• UniProt ID: A2A5A0
• Protein Sequence: Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
• NCBI: NP_058616
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Vp, Atp, Vpp1, Vpp-1, ATP6a1, Atp6n1, Atp6n1a, Atp
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Application: Western blotting, Species+tissue/cell type: HeLa cells, How many ug'sof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate, 2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate, 3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate, 4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-HRP, Secondary antibody dilution: 1:1000.

Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Sample Type: A. untransfected HeLa cells, B. mATP6V0A1 transfected HeLa cells, Primary Antibody Dilution: 1:250, Secondary Antibody: Anti-rabbit AlexaFluor 488, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Atp6v0a1: Green DAPI:Blue, Gene Name: Atp6v0a1.

WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Uterus.