ATP5MD Rabbit Polyclonal Antibody

SKU: orb325550

Description

Rabbit polyclonal antibody to USMG5

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USMG5
• Target: ATP5MD
• Protein Sequence: Synthetic peptide located within the following region: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK
• Molecular Weight: 6kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp566D211 antibody, anti HCVFTP2 antibody, anti MGC14697 antibody, anti bA792D24.4 antibody, anti DAPIT antibody

Sample Tissue: Human H69 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-USMG5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

ATP5MD

UniProt

Q96IX5

RefSeq (Protein):NP_116136