ATP5MD Rabbit Polyclonal Antibody

• Catalog Number: orb325550
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USMG5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USMG5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 6kDa
• Target: ATP5MD
• UniProt ID: Q96IX5
• Protein Sequence: Synthetic peptide located within the following region: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK
• NCBI: NP_116136
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp566D211 antibody, anti HCVFTP2 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human H69 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-USMG5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human heart.