You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580321 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP5F1B |
Target | ATP5F1B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B |
Protein Sequence | Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ |
UniProt ID | P06576 |
MW | 57 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ATP5B, ATPMB, ATPSB, HEL-S-271 |
Note | For research use only |
NCBI | NP_001677 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/ml of the antibody was used in this experiment.
ATP5B antibody - N-terminal region (orb580321) validated by WB using HepG2 cell lysate at 1.25 ug/ml.
ATP5B antibody - N-terminal region (orb580321) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Human Muscle
IHC, IP, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IHC, IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |