ATP5F1B Rabbit Polyclonal Antibody

• Catalog Number: orb580321
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP5F1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Yeast, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57 kDa
• Target: ATP5F1B
• UniProt ID: P06576
• Protein Sequence: Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
• NCBI: NP_001677
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ATP5B, ATPMB, ATPSB, HEL-S-271
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/ml of the antibody was used in this experiment.

ATP5B antibody - N-terminal region (orb580321) validated by WB using HepG2 cell lysate at 1.25 ug/ml.

ATP5B antibody - N-terminal region (orb580321) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Human Muscle