Atp1b2 Rabbit Polyclonal Antibody

• Catalog Number: orb579394
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Atp1b2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-Fr, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33 kDa
• Target: Atp1b2
• UniProt ID: P14231
• Protein Sequence: Synthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
• NCBI: NP_038201
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Am, Amog, Atpb, Atpb-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

WB Suggested Anti-Atp1b2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Kidney.