You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584610 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP1A3 |
Target | ATP1A3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen for Anti-ATP1A3 antibody is: synthetic peptide directed towards the middle region of Human AT1A3 |
Protein Sequence | Synthetic peptide located within the following region: KVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQG |
UniProt ID | P13637 |
MW | 111 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | RDP, AHC2, CAPOS, DYT12, ATP1A1 |
Note | For research use only |
NCBI | NP_689509.1 |
WB Suggested Anti-AT1A3 antibody Titration: 1 ug/ml, Sample Type: Human Large intestine Tumor.
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |