You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580833 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Atl2 |
Target | Atl2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Protein Sequence | Synthetic peptide located within the following region: KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA |
UniProt ID | E9QND8 |
MW | 47kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Ai, Ar, Aip-2, Arl6ip2, AA407293, AV334690, 201011 Read more... |
Note | For research use only |
NCBI | NP_835151 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Atl2 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas.
FC, IHC-P, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |