Atf6 Rabbit Polyclonal Antibody

• Catalog Number: orb574122
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATF6
• Target: Atf6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST
• UniProt ID: B2RU98
• MW: 73 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ESTM4, ESTM49, AA789574, Atf6alpha, 9630036G24, 91
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: NP_001074773
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide antigen is partial match to Mouse protein sequence, recognizes isoforms from 69-72 kDa.

Mouse adipose

WB Suggested Anti-Atf6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.