ATF5 Rabbit Polyclonal Antibody

• Catalog Number: orb329589
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATF5
• Target: ATF5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATF5
• Protein Sequence: Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL
• UniProt ID: Q9Y2D1
• MW: 31kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ATFX antibody, anti HMFN0395 antibody
• Note: For research use only
• NCBI: NP_036200

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.25 ug/mL.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Positive control (+): MCF7 (N10), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 2 ug/mL.