ATF2 Rabbit Polyclonal Antibody

• Catalog Number: orb574956
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATF2
• Target: ATF2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATF2
• Protein Sequence: Synthetic peptide located within the following region: LRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTE
• UniProt ID: P15336
• MW: 55kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HB16, CREB2, TREB7, CREB-2, CRE-BP1
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_001871
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Human Intestine

Human kidney

Rabbit Anti-ATF2 Antibody, Catalog Number: orb574956, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ATF2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.