You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb150766 |
---|---|
Category | Antibodies |
Description | Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | S76-8 |
Tested applications | ICC, IHC, IP, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2b |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Concentration | 1 mg/ml |
Dilution range | WB (1:1000), ICC/IF (1:100) |
Conjugation | Unconjugated |
MW | 85kDa |
Target | Ataxin 1 |
Entrez | 20238 |
UniProt ID | P54254 |
NCBI | NP_001186233.1 |
Storage | -20°C |
Buffer/Preservatives | PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated |
Alternative names | Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, Read more... |
Note | For research use only |
Application notes | 1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody. |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of monkey cos-1 cells transfected with ataxin- 1 using Ataxin 1 antibody
FC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Bovine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating