ASPN Rabbit Polyclonal Antibody

• Catalog Number: orb578495
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASPN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASPN
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43 kDa
• Target: ASPN
• UniProt ID: Q5TBF3
• Protein Sequence: Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
• NCBI: NP_060150
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OS3, PLAP1, PLAP-1, SLRR1C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. ASPN is 43 kDa as a full length protein that is cleaved to ~38 kDa. A smaller isoform of 18-20 kDa is also detected. The mature form is also N-linked glycosylated.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Lung tumor (T-LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

Human Muscle

WB Suggested Anti-ASPN Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.