You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581364 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASPH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ASPH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | ASPH |
UniProt ID | Q12797 |
Protein Sequence | Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD |
NCBI | NP_064549 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AAH, BAH, HAAH, JCTN, FDLAB, junctin, CASQ2BP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. ASPH is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that ASPH is expressed in HepG2.
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Canine, Equine, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |