ASPH Rabbit Polyclonal Antibody

• Catalog Number: orb581364
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASPH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASPH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: ASPH
• UniProt ID: Q12797
• Protein Sequence: Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD
• NCBI: NP_064549
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AAH, BAH, HAAH, JCTN, FDLAB, junctin, CASQ2BP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. ASPH is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that ASPH is expressed in HepG2.