ASCL2 Rabbit Polyclonal Antibody

• Catalog Number: orb576146
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASCL2
• Target: ASCL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ASCL2
• Protein Sequence: Synthetic peptide located within the following region: PHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPP
• UniProt ID: O35885
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Mas, Mash2, bHLHa, bHLHa45, 2410083I15Rik
• Research Area: Epigenetics & Chromatin, Neuroscience, Stem Cell &
• Note: For research use only
• NCBI: NP_032580

WB Suggested Anti-ASCL2 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.