You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576146 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASCL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Porcine, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse ASCL2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | ASCL2 |
UniProt ID | O35885 |
Protein Sequence | Synthetic peptide located within the following region: PHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPP |
NCBI | NP_032580 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Mas, Mash2, bHLHa, bHLHa45, 2410083I15Rik Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ASCL2 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Rabbit, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |