You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573779 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASCL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASCL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | ASCL1 |
UniProt ID | P50553 |
Protein Sequence | Synthetic peptide located within the following region: QAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYS |
NCBI | NP_004307 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ASH1, HASH1, MASH1, bHLHa46 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Sample Type: RPMI-8226 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |