Cart summary

You have no items in your shopping cart.

ASB1 Rabbit Polyclonal Antibody (HRP)

ASB1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2091980

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2091980
CategoryAntibodies
DescriptionASB1 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
Protein SequenceSynthetic peptide located within the following region: PGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEA
UniProt IDQ9Y576
MW29kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesASB-1
NoteFor research use only
NCBIBAA86460
Expiration Date12 months from date of receipt.