AS3MT antibody

Catalog Number: orb325426

Catalog Number	orb325426
Category	Antibodies
Description	Rabbit polyclonal antibody to AS3MT
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Reactivity	Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Zebrafish
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human AS3MT
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	42 kDa
Target	AS3MT
UniProt ID	Q9HBK9
Protein Sequence	Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
NCBI	NP_065733
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti CYT19 antibody, anti RP11-753C18.6 antibody Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Western blot analysis of Jurkat cell lysate tissue using AS3MT antibody