AS3MT Rabbit Polyclonal Antibody

• Catalog Number: orb325426
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AS3MT
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AS3MT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42 kDa
• Target: AS3MT
• UniProt ID: Q9HBK9
• Protein Sequence: Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
• NCBI: NP_065733
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CYT19 antibody, anti RP11-753C18.6 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Positive control (+): HepG2 (HG), Negative control (-): MCF7 (N10), Antibody concentration: 5 ug/mL.

WB Suggested Anti-AS3MT Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.