ARRDC4 Rabbit Polyclonal Antibody

• Catalog Number: orb582713
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARRDC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ARRDC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: ARRDC4
• UniProt ID: Q8NCT1
• Protein Sequence: Synthetic peptide located within the following region: PYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFI
• NCBI: NP_899232.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Lane 1: human lung, Lane 2: human liver, Antibody dilution: 1.0 ug/ml.

Sample Type: THP-1 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.