You have no items in your shopping cart.
Arpin Rabbit Polyclonal Antibody
Description
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | Arpin |
| Protein Sequence | Synthetic peptide located within the following region: RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD |
| Molecular Weight | 25kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Arpin Rabbit Polyclonal Antibody (HRP) [orb2104421]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μlArpin Rabbit Polyclonal Antibody (FITC) [orb2104422]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μlArpin Rabbit Polyclonal Antibody (Biotin) [orb2104423]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-2610034B18Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Spleen.
Documents Download
Request a Document
Arpin Rabbit Polyclonal Antibody (orb326041)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review