You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330986 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARPC2 |
Target | ARPC2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2 |
Protein Sequence | Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL |
UniProt ID | O15144 |
MW | 33kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ARC34 antibody, anti PNAS-139 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_005722 |
WB Suggested Anti-ARPC2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
ICC, IHC-P, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Other, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Other, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |