ARNTL2 Rabbit Polyclonal Antibody

• Catalog Number: orb577099
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARNTL2
• Target: ARNTL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL2
• Protein Sequence: Synthetic peptide located within the following region: PTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLST
• UniProt ID: Q8WYA1
• MW: 71 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CLIF, MOP9, BMAL2, PASD9, bHLHe6
• Note: For research use only
• NCBI: NP_064568

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 62 kDa isoform.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-ARNTL2 antibody (orb577099).

WB Suggested Anti-ARNTL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.