You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577099 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARNTL2 |
Target | ARNTL2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Mouse |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL2 |
Protein Sequence | Synthetic peptide located within the following region: PTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLST |
UniProt ID | Q8WYA1 |
MW | 71 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CLIF, MOP9, BMAL2, PASD9, bHLHe6 |
Note | For research use only |
NCBI | NP_064568 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 62 kDa isoform.
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-ARNTL2 antibody (orb577099).
WB Suggested Anti-ARNTL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
WB | |
Bovine, Canine, Equine, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |