ARL6IP5 Rabbit Polyclonal Antibody

• Catalog Number: orb588762
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARL6IP5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARL6IP5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 22 kDa
• Target: ARL6IP5
• UniProt ID: Q8R5J9
• Protein Sequence: Synthetic peptide located within the following region: MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
• NCBI: NP_075368.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ai, add, Aip-5, Gtrap3, AV001879, addiscin, Gtrap3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas lysates, Antibody Dilution: 1.0 ug/ml.