Cart summary

You have no items in your shopping cart.

ARL5A Rabbit Polyclonal Antibody (Biotin)

ARL5A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2104558

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104558
CategoryAntibodies
DescriptionARL5A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARL5A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW20kDa
UniProt IDQ9Y689
Protein SequenceSynthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA
NCBINP_036229
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesARL5, ARFLP5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.