You have no items in your shopping cart.
ARHGEF10 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARHGEF10 |
| Target | ARHGEF10 |
| Protein Sequence | Synthetic peptide located within the following region: SRDSLAPGPEPQDEDQKDALPSGGAGSSLSQGDPDAAIWLGDSLGSMTQK |
| Molecular Weight | 149kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ARHGEF10 rabbit pAb Antibody [orb764572]
ELISA, IF, IHC, WB
Human, Monkey
Polyclonal
Unconjugated
100 μl, 50 μlARHGEF10 Rabbit Polyclonal Antibody [orb624842]
ELISA, IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-ARHGEF10 Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell. ARHGEF10 is supported by BioGPS gene expression data to be expressed in ACHN.
Documents Download
Request a Document
ARHGEF10 Rabbit Polyclonal Antibody (orb586278)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






