Cart summary

You have no items in your shopping cart.

ARHGAP6 Rabbit Polyclonal Antibody

Catalog Number: orb55819

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb55819
CategoryAntibodies
DescriptionRabbit polyclonal antibody to ARHGAP6.
TargetARHGAP6
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP6
Protein SequenceSynthetic peptide located within the following region: ARSEQYLTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPY
UniProt IDO43182
MW107 kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesRHOGAP6, RHOGAPX-1
Research AreaCell Biology, Signal Transduction
NoteFor research use only
NCBINP_006116.2
Images
ARHGAP6 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell lysates, Antibody dilution: 1 ug/ml.

Reviews

ARHGAP6 Rabbit Polyclonal Antibody (orb55819)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet