Cart summary

You have no items in your shopping cart.

ARHGAP45 Rabbit Polyclonal Antibody (Biotin)

ARHGAP45 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2105935

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105935
CategoryAntibodies
DescriptionARHGAP45 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of human HMHA1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW84kDa
UniProt IDK7ES92
Protein SequenceSynthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP
NCBINP_001269263.1
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHA-1, HMHA1, HLA-HA1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.