You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325784 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARHGAP36 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Goat, Human, Mouse, Porcine, Rabbit, Sheep |
Reactivity | Equine, Goat, Human, Mouse, Porcine, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP36. |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | ARHGAP36 |
UniProt ID | Q6ZRI8 |
Protein Sequence | Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH |
NCBI | NP_659404 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ30058 antibody, anti RP13-102H20.1 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MCF7 Whole Cell tissue using ARHGAP36 antibody
WB | |
Animal, Bovine, Canine, Goat, Guinea pig, Human, Porcine, Sheep | |
Canine, Equine, Goat, Guinea pig, Human, Porcine, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating