ARHGAP36 Rabbit Polyclonal Antibody

• Catalog Number: orb325784
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARHGAP36
• Target: ARHGAP36
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Goat, Mouse, Porcine, Rabbit, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP36.
• Protein Sequence: Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH
• UniProt ID: Q6ZRI8
• MW: 62kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ30058 antibody, anti RP13-102H20.1 antibod
• Note: For research use only
• NCBI: NP_659404

WB Suggested Anti-ARHGAP36 Antibody, Titration: 1 ug/mL, Positive Control: MCF7 Whole Cell.