You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582384 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARG2 |
Target | ARG2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ARG2 |
Protein Sequence | Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT |
UniProt ID | P78540 |
MW | 39kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001163 |
ARG2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb582384 with 1:200 dilution. Western blot was performed using orb582384 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: ARG2 IP with orb582384 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ARG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. ARG2 is supported by BioGPS gene expression data to be expressed in Jurkat.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |