Arfrp1 Rabbit Polyclonal Antibody

• Catalog Number: orb588069
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Arfrp1
• Target: Arfrp1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen for Anti-Arfrp1 antibody is: synthetic peptide directed towards the N-terminal of Rat ARFRP
• Protein Sequence: Synthetic peptide located within the following region: TLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSK
• UniProt ID: Q63055
• MW: 22 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: XP_006235780.1

Sample Type: Rat Muscle, Antibody Dilution: 1.0 ug/ml.