You have no items in your shopping cart.
Cart summary
Item 1 of 1
ARFGAP3 Rabbit Polyclonal Antibody
Catalog Number: orb331155
| Catalog Number | orb331155 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ARFGAP3 |
| Target | ARFGAP3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: FHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP |
| UniProt ID | Q9NP61 |
| MW | 57kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti ARFGAP1 antibody, anti FLJ45618 antibody |
| Note | For research use only |
| NCBI | NP_055385 |
WB Suggested Anti-ARFGAP3 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, ARFGAP3 is supported by BioGPS gene expression data to be expressed in 721_B.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
ARFGAP3 Rabbit Polyclonal Antibody [orb331154]
WB
Bovine, Canine, Equine, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl
