You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574429 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to APTX |
Target | APTX |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human APTX |
Protein Sequence | Synthetic peptide located within the following region: YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSN |
UniProt ID | Q5T782 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT |
Note | For research use only |
NCBI | NP_778239 |
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. APTX is supported by BioGPS gene expression data to be expressed in HEK293T.
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. APTX is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-APTX Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |