You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1176909 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TNFSF13 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids. |
Dilution range | Western blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
Target | TNFSF13 |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing |
Buffer/Preservatives | Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request |
Alternative names | A proliferation inducing ligand antibody, A prolif Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating