APRIL Antibody

• Catalog Number: orb1176909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNFSF13
• Target: TNFSF13
• Clonality: Polyclonal
• Species/Host: Rabbit
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Human
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
• Purification: Immunogen affinity purified.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
• Tested applications: ELISA, WB
• Dilution range: Western blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A proliferation inducing ligand antibody, A prolif
• Note: For research use only
• Expiration Date: 12 months from date of receipt.