Cart summary

You have no items in your shopping cart.

APRIL Antibody

SKU: orb1176909

Description

Rabbit polyclonal antibody to TNFSF13

Images & Validation

Tested ApplicationsELISA, WB
Dilution RangeWestern blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml
ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
TargetTNFSF13
PurificationImmunogen affinity purified.
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearanceLyophilized
Buffer/PreservativesAntibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

A proliferation inducing ligand antibody, A proliferation-inducing ligand antibody, APRIL antibody, CD 256 antibody, CD256 antibody, CD256 antigen antibody, Ligand antibody, PRO715 antibody, Proliferation inducing ligand APRIL antibody, TALL 2 antibody, TALL-2 antibody, TALL2 antibody, TNF and APOL related leukocyte expressed ligand 2 antibody, TNF related death ligand 1 antibody, TNF related death ligand antibody, TNF- and APOL-related leukocyte expressed ligand 2 antibody, TNF-related death ligand 1 antibody, TNF13_ HUMAN antibody, TNFSF 13 antibody, TNFSF13 antibody, TNFSF13 protein antibody, TRDL 1 antibody, TRDL-1 antibody, TRDL1 antibody, Tumor necrosis factor (ligand) superfamily member 13 antibody, Tumor necrosis factor (ligand) superfamily, member 13 antibody, Tumor necrosis factor ligand superfamily member 13 antibody, Tumor necrosis factor like protein ZTNF2 antibody, Tumor necrosis factor related death ligand antibody, Tumor necrosis factor related death ligand 1 antibody, Tumor necrosis factor superfamily member 13 antibody, TWE PRIL antibody, UNQ383 antibody, UNQ383/ PRO715 antibody, ZTNF 2 antibody, ZTNF2 antibody

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol

APRIL Antibody (orb1176909)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 690.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry