You have no items in your shopping cart.
APRIL Antibody
SKU: orb1176909
Description
Images & Validation
−
| Tested Applications | ELISA, WB |
|---|---|
| Dilution Range | Western blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml |
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids. |
| Target | TNFSF13 |
| Purification | Immunogen affinity purified. |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−A proliferation inducing ligand antibody, A proliferation-inducing ligand antibody, APRIL antibody, CD 256 antibody, CD256 antibody, CD256 antigen antibody, Ligand antibody, PRO715 antibody, Proliferation inducing ligand APRIL antibody, TALL 2 antibody, TALL-2 antibody, TALL2 antibody, TNF and APOL related leukocyte expressed ligand 2 antibody, TNF related death ligand 1 antibody, TNF related death ligand antibody, TNF- and APOL-related leukocyte expressed ligand 2 antibody, TNF-related death ligand 1 antibody, TNF13_ HUMAN antibody, TNFSF 13 antibody, TNFSF13 antibody, TNFSF13 protein antibody, TRDL 1 antibody, TRDL-1 antibody, TRDL1 antibody, Tumor necrosis factor (ligand) superfamily member 13 antibody, Tumor necrosis factor (ligand) superfamily, member 13 antibody, Tumor necrosis factor ligand superfamily member 13 antibody, Tumor necrosis factor like protein ZTNF2 antibody, Tumor necrosis factor related death ligand antibody, Tumor necrosis factor related death ligand 1 antibody, Tumor necrosis factor superfamily member 13 antibody, TWE PRIL antibody, UNQ383 antibody, UNQ383/ PRO715 antibody, ZTNF 2 antibody, ZTNF2 antibody
Similar Products
−APRIL rabbit pAb Antibody [orb764560]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlPHAPI2 rabbit pAb Antibody [orb767379]
ELISA, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlHuman Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit [orb776031]
Human
46.88-3000 pg/mL
15.74 pg/mL
96 T, 48 TMouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit [orb777630]
Mouse
0.63-40 ng/mL
0.258 ng/mL
48 T, 96 TRat Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit [orb781097]
Rat
0.32-20 ng/mL
0.123 ng/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
TNFSF13
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
APRIL Antibody (orb1176909)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









