Cart summary

You have no items in your shopping cart.

    APRIL antibody

    APRIL antibody

    Catalog Number: orb1176909

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb1176909
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to TNFSF13
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, WB
    ReactivityHuman
    IsotypeIgG
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
    Dilution rangeWestern blot: 0.1-0.5μg/ml. ELISA: 0.1-0.5μg/ml
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    TargetTNFSF13
    StorageAt -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing
    Buffer/PreservativesAntibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
    Alternative namesA proliferation inducing ligand antibody, A prolif
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    • TNFSF13 antibody [orb685489]

      ELISA,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • TNFSF13 antibody [orb214825]

      IF,  IH,  WB

      Human, Mouse, Porcine, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 30 μl
    • PHAPI2 antibody [orb767379]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      50ul, 100ul
    • APRIL antibody [orb764560]

      ELISA,  IF,  IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      50ul, 100ul
    • SSP29 antibody [orb18473]

      ELISA,  IHC,  WB

      Bovine, Canine, Human, Mouse, Porcine, Rat

      Goat

      Polyclonal

      Unconjugated

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars