APOH Rabbit Polyclonal Antibody

• Catalog Number: orb581279
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: APOH
• UniProt ID: P02749
• Protein Sequence: Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
• NCBI: NP_000033
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BG, B2G1, B2GP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-APOH Antibody, Catalog Number: orb581279, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-APOH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. APOH is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-APOH antibody Titration: 1 ug/ml, Sample Type: Human liver.