Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

APOA2 Rabbit Polyclonal Antibody

SKU: orb582397

Description

Rabbit polyclonal antibody to APOA2

Research Area

Epigenetics, Infectious Diseases

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOA2
TargetAPOA2
Protein SequenceSynthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Molecular Weight11 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

apoAII, Apo-AII, ApoA-II

Similar Products

  • APOA2 Rabbit Polyclonal Antibody [orb624796]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • APOA2 rabbit pAb Antibody [orb773718]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • APOA2 Rabbit Polyclonal Antibody [orb2955732]

    ELISA,  IHC,  WB

    Bacteria, Human, Monkey, Primate

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • APOA2 Rabbit Polyclonal Antibody [orb5707]

    IF,  IHC-Fr,  IHC-P

    Canine, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • APOA2 Rabbit Polyclonal Antibody (HRP) [orb2106425]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

APOA2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by phosphorylation.

APOA2 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

APOA2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

APOA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

APOA2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

APOA2 Rabbit Polyclonal Antibody

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

APOA2 Rabbit Polyclonal Antibody

WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001634

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

APOA2 Rabbit Polyclonal Antibody (orb582397)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry