APOA2 Rabbit Polyclonal Antibody

• Catalog Number: orb582397
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOA2
• Target: APOA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOA2
• Protein Sequence: Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
• UniProt ID: P02652
• MW: 11 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: apoAII, Apo-AII, ApoA-II
• Note: For research use only
• NCBI: NP_001634

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by phosphorylation.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate.