You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592803 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to APBA1 |
| Target | APBA1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1 |
| Protein Sequence | Synthetic peptide located within the following region: PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD |
| UniProt ID | Q02410 |
| MW | 93kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | X11, X11A, LIN10, MINT1, D9S411E, X11ALPHA |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | EAW62487 |

Human Intestine

Sample Type: Rat Hippocampal Neurons - 14DIV, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: White: APBA1, Gene Name: APBA1.

WB Suggested Anti-APBA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate. APBA1 is supported by BioGPS gene expression data to be expressed in Raji.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
PE |
IF | |
Bovine, Canine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review