APBA1 Rabbit Polyclonal Antibody

SKU: orb592803

Description

APBA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of APBA1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1. This antibody reacts with Human, Rat samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Rat
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1
• Target: APBA1
• Protein Sequence: Synthetic peptide located within the following region: PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD
• Molecular Weight: 93kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

X11, X11A, LIN10, MINT1, D9S411E, X11ALPHA

Quick Database Links

Gene Symbol

APBA1

UniProt

Q02410

RefSeq:EAW62487