APBA1 Rabbit Polyclonal Antibody

• Catalog Number: orb592803
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APBA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: APBA1
• UniProt ID: Q02410
• Protein Sequence: Synthetic peptide located within the following region: PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD
• NCBI: EAW62487
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: X11, X11A, LIN10, MINT1, D9S411E, X11ALPHA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Intestine

Sample Type: Rat Hippocampal Neurons - 14DIV, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: White: APBA1, Gene Name: APBA1.

WB Suggested Anti-APBA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate. APBA1 is supported by BioGPS gene expression data to be expressed in Raji.