Cart summary

You have no items in your shopping cart.

AP3M2 Rabbit Polyclonal Antibody (Biotin)

AP3M2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2109574

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2109574
CategoryAntibodies
DescriptionAP3M2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AP3M2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW47kDa
UniProt IDP53677
Protein SequenceSynthetic peptide located within the following region: VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID
NCBINP_006794
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesP47B, AP47B, CLA20
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.