You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574772 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ap3b1 |
| Target | Ap3b1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Human, Mouse, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
| Protein Sequence | Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
| UniProt ID | D4AA25 |
| MW | 121kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Ap3b1 |
| Research Area | Cancer Biology, Cell Biology, Immunology & Inflamm Read more... |
| Note | For research use only |
| NCBI | EDM10075 |

AP3B1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574772 with 1:200 dilution. Western blot was performed using orb574772 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: AP3B1 IP with orb574772 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-Ap3b1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Liver.
WB | |
Bovine, Canine, Equine, Feline, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Feline, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review