Ap3b1 Rabbit Polyclonal Antibody

• Catalog Number: orb574772
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ap3b1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Mouse, Porcine
• Reactivity: Rat
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 121kDa
• Target: Ap3b1
• UniProt ID: D4AA25
• Protein Sequence: Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
• NCBI: EDM10075
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ap3b1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AP3B1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574772 with 1:200 dilution. Western blot was performed using orb574772 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: AP3B1 IP with orb574772 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-Ap3b1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Liver.