AP1B1 Rabbit Polyclonal Antibody

• Catalog Number: orb331499
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AP1B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 104kDa
• Target: AP1B1
• UniProt ID: Q10567
• Protein Sequence: Synthetic peptide located within the following region: PSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGD
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AP1B1 antibody, anti ADTB1 antibody, anti BAM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml.