Antp Rabbit Polyclonal Antibody

• Catalog Number: orb325376
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Antp
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Drosophila
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: Antp
• UniProt ID: P02833
• Protein Sequence: Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
• NCBI: NP_996176
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Dmel_CG1028 antibody, anti 3.4 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Antp Antibody Titration: 0.2-1 ug/mL, Positive Control: Drosophila.