You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325376 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Antp |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Drosophila |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | Antp |
UniProt ID | P02833 |
Protein Sequence | Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
NCBI | NP_996176 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Dmel_CG1028 antibody, anti 3.4 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Antp Antibody Titration: 0.2-1 ug/mL, Positive Control: Drosophila.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Mouse, Porcine, Rabbit, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |