Antp Rabbit Polyclonal Antibody

SKU: orb325376

Description

Antp Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Antp. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Fruit fly. This antibody reacts with Drosophila samples. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Drosophila

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Target: Antp
• Protein Sequence: Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Dmel_CG1028 antibody, anti 3.4 antibody, anti ANT-C antibody, anti ANT-P antibody, anti Ant antibody, anti AntP antibody, anti AntP1 antibody, anti CG1028 antibody, anti DMANTPE1 antibody, anti DRO15DC96Z antibody, anti DmAntp antibody, anti Hu antibody, anti Scx antibody, anti l(3)84Ba antibody, anti ANTC antibody, anti antp antibody, anti ANTP antibody, anti Antp P1 antibody, anti Antp P2 antibody, anti Antp1 antibody, anti Aus antibody, anti BG:DS07700.1 antibody, anti Dmel\CG1028 antibody, anti Ns antibody

Quick Database Links

Gene Symbol

Antp

UniProt

P02833

RefSeq (Protein):NP_996176