SP6 Rabbit Polyclonal Antibody

SKU: orb402579

Description

Anti-SP6 Antibody. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience

Images & Validation

• Tested Applications: ICC, IF, IHC, WB
• Dilution Range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5 μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml
• Reactivity: Human, Mouse, Rat
• Application Notes:
  Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Key Properties

• Antibody Type: Primary Antibody
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
• Target: Transcription factor Sp6
• Molecular Weight: 40 kDa
• Purification: Immunogen affinity purified.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SP6; KLF14; Transcription factor Sp6; Krueppel-like factor 14

WB analysis of SP6 using anti-SP6 antibody.Lane 1:human placenta tissue;2:human MCF-7 Cells;3:rat spleen tissue;4:mouse spleen tissue.

Quick Database Links

Gene Symbol

Transcription factor Sp6

UniProt

Q3SY56