SP6 Rabbit Polyclonal Antibody

SKU: orb402579

Description

The SP6 Rabbit Polyclonal Antibody is an unconjugated antibody raised in rabbit. It is immunogen affinity purified and suitable for use in ICC, IF, IHC, and WB applications. This antibody targets the Transcription factor Sp6 in Human, Mouse, and Rat samples.

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience

Images & Validation

• Tested Applications: ICC, IF, IHC, WB
• Dilution Range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5 μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml
• Reactivity: Human, Mouse, Rat
• Application Notes:
  Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Key Properties

• Antibody Type: Primary Antibody
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
• Target: Transcription factor Sp6
• Molecular Weight: 40 kDa
• Purification: Immunogen affinity purified.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SP6; KLF14; Transcription factor Sp6; Krueppel-like factor 14

Quick Database Links

Gene Symbol

Transcription factor Sp6

UniProt

Q3SY56