You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IHC, WB |
|---|---|
| Dilution Range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5 μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Related Conjugates & Formulations
−Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Immunogen | A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH). |
| Target | Transcription factor Sp6 |
| Molecular Weight | 40 kDa |
| Purification | Immunogen affinity purified. |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4. |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SP6 Rabbit Polyclonal Antibody [orb1097961]
ELISA, FC, ICC, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgSP6 Rabbit Polyclonal Antibody [orb1880579]
FC, WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB analysis of SP6 using anti-SP6 antibody.Lane 1:human placenta tissue;2:human MCF-7 Cells;3:rat spleen tissue;4:mouse spleen tissue.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
SP6 Rabbit Polyclonal Antibody (orb402579)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








