Cart summary

You have no items in your shopping cart.

ANO5 Rabbit Polyclonal Antibody (FITC)

ANO5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090322

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090322
CategoryAntibodies
DescriptionANO5 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityCanine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW107 kDa
UniProt IDQ75V66
Protein SequenceSynthetic peptide located within the following region: IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
NCBINP_998764
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGDD1, LGMD2L, LGMDR12, TMEM16E
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.